PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_025082
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family SBP
Protein Properties Length: 216aa    MW: 24320.9 Da    PI: 10.233
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_025082genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.94.5e-4167144178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cq+egC+adl++ak+yhrrhkvCe+hska++v++sgl+qrfCqqCsrfh l+efD++krsCr+rLa+hn+rrrk+++
  DCAR_025082  67 RCQAEGCNADLTHAKHYHRRHKVCEFHSKAATVIASGLTQRFCQQCSRFHLLTEFDNGKRSCRKRLADHNRRRRKTHQ 144
                  6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.5E-3562129IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.34265142IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.19E-3866144IPR004333Transcription factor, SBP-box
PfamPF031104.8E-3168141IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MISFDPVHDP TGFIIVPKTE PASSEFTSRI GLNLGGRTYF SSSEDDFVNR LYRRSRAIET  60
GSVNAPRCQA EGCNADLTHA KHYHRRHKVC EFHSKAATVI ASGLTQRFCQ QCSRFHLLTE  120
FDNGKRSCRK RLADHNRRRR KTHQTNQDQS SKSQLENAHN SSSENLTRSP PDSSLQSSSS  180
VTMPISPPRI SLDSFRQRLN YQGSSSSTNS RFLNE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-3260141384squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090046.11e-106PREDICTED: squamosa promoter-binding-like protein 8
RefseqXP_012083646.11e-106PREDICTED: squamosa promoter-binding-like protein 8
SwissprotQ8GXL33e-74SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLA0A067JXX71e-106A0A067JXX7_JATCU; Uncharacterized protein
STRINGPOPTR_0014s05680.11e-100(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48462341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.16e-74squamosa promoter binding protein-like 8